Lineage for d3nh1a_ (3nh1 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1607175Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1607536Protein automated matches [190162] (4 species)
    not a true protein
  7. 1607547Species Escherichia coli [TaxId:562] [187263] (13 PDB entries)
  8. 1607557Domain d3nh1a_: 3nh1 A: [247925]
    automated match to d2f96a1
    protein/DNA complex; protein/RNA complex; complexed with mg

Details for d3nh1a_

PDB Entry: 3nh1 (more details), 2.11 Å

PDB Description: Crystal structure of RNase T in complex with a preferred ssDNA (TAGG) with two Mg in the active site
PDB Compounds: (A:) Ribonuclease T

SCOPe Domain Sequences for d3nh1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nh1a_ c.55.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
naqltglcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhve
pfvganlqpealafngidpndpdrgavseyealheifkvvrkgikasgcnraimvahnan
fdhsfmmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsa
lydtertavlfceivnrwkrlggwplsaa

SCOPe Domain Coordinates for d3nh1a_:

Click to download the PDB-style file with coordinates for d3nh1a_.
(The format of our PDB-style files is described here.)

Timeline for d3nh1a_: