| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins) contains Pfam PF00929 |
| Protein automated matches [190162] (4 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187263] (13 PDB entries) |
| Domain d3ngyd_: 3ngy D: [247920] automated match to d2f96a1 complexed with co; mutant |
PDB Entry: 3ngy (more details), 2.2 Å
SCOPe Domain Sequences for d3ngyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ngyd_ c.55.3.5 (D:) automated matches {Escherichia coli [TaxId: 562]}
tglcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvg
anlqpealafngidpndpdrgavsgyealheifkvvrkgikasgcnraimvahnanfdhs
fmmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydt
ertavlfceivnrwkrlggwpl
Timeline for d3ngyd_: