SCOPe 2.04: Domain d3ngyd_: 3ngy D:

Lineage for d3ngyd_ (3ngy D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
   contains Pfam PF00929

6. Protein automated matches [190162] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187263] (13 PDB entries)

8. Domain d3ngyd_: 3ngy D: [247920]
   automated match to d2f96a1
   complexed with co; mutant

Details for d3ngyd_

PDB Entry: 3ngy, 2.2 Å

PDB Description: Crystal structure of RNase T (E92G mutant)

PDB Compounds: (D:) Ribonuclease T

SCOPe Domain Sequences for d3ngyd_:

Sequence; same for both SEQRES and ATOM records:

>d3ngyd_ c.55.3.5 (D:) automated matches {Escherichia coli [TaxId: 562]}
tglcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvg
anlqpealafngidpndpdrgavsgyealheifkvvrkgikasgcnraimvahnanfdhs
fmmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydt
ertavlfceivnrwkrlggwpl

Timeline for d3ngyd_:

• d3ngyd_ is new in SCOPe 2.04-stable
  
• d3ngyd_ appears in SCOPe 2.05
  
• d3ngyd_ appears in the current release, SCOPe 2.08