Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein automated matches [190162] (6 species) not a true protein |
Species Escherichia coli [TaxId:562] [187263] (14 PDB entries) |
Domain d3ngyc_: 3ngy C: [247919] automated match to d2f96a1 complexed with co; mutant |
PDB Entry: 3ngy (more details), 2.2 Å
SCOPe Domain Sequences for d3ngyc_:
Sequence, based on SEQRES records: (download)
>d3ngyc_ c.55.3.5 (C:) automated matches {Escherichia coli [TaxId: 562]} glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvga nlqpealafngidpndpdrgavsgyealheifkvvrkgikasgcnraimvahnanfdhsf mmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydte rtavlfceivnrwkrlggwpls
>d3ngyc_ c.55.3.5 (C:) automated matches {Escherichia coli [TaxId: 562]} glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvgg avsgyealheifkvvrkgikasgcnraimvahnanfdhsfmmaaaeraslkrnpfhpfat fdtaalaglalgqtvlskacqtagmdfdstqahsalydtertavlfceivnrwkrlggwp ls
Timeline for d3ngyc_: