SCOPe 2.08: Domain d3ngyc_: 3ngy C:

Lineage for d3ngyc_ (3ngy C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein automated matches [190162] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187263] (14 PDB entries)

8. Domain d3ngyc_: 3ngy C: [247919]
   automated match to d2f96a1
   complexed with co; mutant

Details for d3ngyc_

PDB Entry: 3ngy, 2.2 Å

PDB Description: Crystal structure of RNase T (E92G mutant)

PDB Compounds: (C:) Ribonuclease T

SCOPe Domain Sequences for d3ngyc_:

Sequence, based on SEQRES records:

>d3ngyc_ c.55.3.5 (C:) automated matches {Escherichia coli [TaxId: 562]}
glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvga
nlqpealafngidpndpdrgavsgyealheifkvvrkgikasgcnraimvahnanfdhsf
mmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydte
rtavlfceivnrwkrlggwpls

Sequence, based on observed residues (ATOM records):

>d3ngyc_ c.55.3.5 (C:) automated matches {Escherichia coli [TaxId: 562]}
glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvgg
avsgyealheifkvvrkgikasgcnraimvahnanfdhsfmmaaaeraslkrnpfhpfat
fdtaalaglalgqtvlskacqtagmdfdstqahsalydtertavlfceivnrwkrlggwp
ls

Timeline for d3ngyc_:

• d3ngyc_ first appeared in SCOPe 2.04
  
• d3ngyc_ appears in SCOPe 2.07