Lineage for d3ngyb_ (3ngy B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886872Protein automated matches [190162] (6 species)
    not a true protein
  7. 2886889Species Escherichia coli [TaxId:562] [187263] (14 PDB entries)
  8. 2886896Domain d3ngyb_: 3ngy B: [247918]
    automated match to d2f96a1
    complexed with co; mutant

Details for d3ngyb_

PDB Entry: 3ngy (more details), 2.2 Å

PDB Description: Crystal structure of RNase T (E92G mutant)
PDB Compounds: (B:) Ribonuclease T

SCOPe Domain Sequences for d3ngyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ngyb_ c.55.3.5 (B:) automated matches {Escherichia coli [TaxId: 562]}
tglcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvg
anlqpealafngidpndpdrgavsgyealheifkvvrkgikasgcnraimvahnanfdhs
fmmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydt
ertavlfceivnrwkrlggwpl

SCOPe Domain Coordinates for d3ngyb_:

Click to download the PDB-style file with coordinates for d3ngyb_.
(The format of our PDB-style files is described here.)

Timeline for d3ngyb_: