SCOPe 2.05: Domain d3nfua1: 3nfu A:1-132

Lineage for d3nfua1 (3nfu A:1-132)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries)

8. Domain d3nfua1: 3nfu A:1-132 [247901]
   Other proteins in same PDB: d3nfua2, d3nfub2
   automated match to d3mznb1
   complexed with gol, mg, so4

Details for d3nfua1

PDB Entry: 3nfu, 1.94 Å

PDB Description: crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium

PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d3nfua1:

Sequence; same for both SEQRES and ATOM records:

>d3nfua1 d.54.1.0 (A:1-132) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
lfpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegilngl
ekcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdlfg
qalgmpvadllg

Timeline for d3nfua1:

• d3nfua1 first appeared in SCOPe 2.04
  
• d3nfua1 appears in SCOPe 2.06
  
• d3nfua1 appears in the current release, SCOPe 2.08