Class b: All beta proteins [48724] (180 folds) |
Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily) core: barrel, in some members open; n*=4, S*=8; meander |
Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families) |
Family b.37.1.1: N-terminal domains of the minor coat protein g3p [50177] (3 proteins) |
Protein N-terminal domains of the minor coat protein g3p, N-terminal domain [418916] (2 species) protein duplication: the two domains share a common fold |
Species Bacteriophage M13 [TaxId:10870] [419342] (2 PDB entries) |
Domain d1tola1: 1tol A:1-65 [24790] Other proteins in same PDB: d1tola2, d1tola3 |
PDB Entry: 1tol (more details), 1.85 Å
SCOPe Domain Sequences for d1tola1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tola1 b.37.1.1 (A:1-65) N-terminal domains of the minor coat protein g3p, N-terminal domain {Bacteriophage M13 [TaxId: 10870]} aetvesclakshtensftnvwkddktldryanyegclwnatgvvvctgdetqcygtwvpi glaip
Timeline for d1tola1: