Lineage for d1tola1 (1tol A:1-65)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786733Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)
    core: barrel, in some members open; n*=4, S*=8; meander
  4. 2786734Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families) (S)
  5. 2786735Family b.37.1.1: N-terminal domains of the minor coat protein g3p [50177] (3 proteins)
  6. 2786742Protein N-terminal domains of the minor coat protein g3p, N-terminal domain [418916] (2 species)
    protein duplication: the two domains share a common fold
  7. 2786747Species Bacteriophage M13 [TaxId:10870] [419342] (2 PDB entries)
  8. 2786749Domain d1tola1: 1tol A:1-65 [24790]
    Other proteins in same PDB: d1tola2, d1tola3

Details for d1tola1

PDB Entry: 1tol (more details), 1.85 Å

PDB Description: fusion of n-terminal domain of the minor coat protein from gene iii in phage m13, and c-terminal domain of e. coli protein-tola
PDB Compounds: (A:) protein (fusion protein consisting of minor coat protein, glycine rich linker, tola, and a his tag)

SCOPe Domain Sequences for d1tola1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tola1 b.37.1.1 (A:1-65) N-terminal domains of the minor coat protein g3p, N-terminal domain {Bacteriophage M13 [TaxId: 10870]}
aetvesclakshtensftnvwkddktldryanyegclwnatgvvvctgdetqcygtwvpi
glaip

SCOPe Domain Coordinates for d1tola1:

Click to download the PDB-style file with coordinates for d1tola1.
(The format of our PDB-style files is described here.)

Timeline for d1tola1: