SCOPe 2.06: Domain d3ne4a_: 3ne4 A:

Lineage for d3ne4a_ (3ne4 A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.1: Serpins [56573] (1 superfamily)
   contains a cluster of helices and a beta-sandwich

4. Superfamily e.1.1: Serpins [56574] (2 families)

5. Family e.1.1.1: Serpins [56575] (17 proteins)
   automatically mapped to Pfam PF00079

6. Protein automated matches [190484] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188559] (15 PDB entries)

8. Domain d3ne4a_: 3ne4 A: [247898]
   automated match to d1hp7a_

Details for d3ne4a_

PDB Entry: 3ne4, 1.81 Å

PDB Description: 1.8 Angstrom structure of intact native wild-type alpha-1-antitrypsin

PDB Compounds: (A:) alpha-1-antitrypsin

SCOPe Domain Sequences for d3ne4a_:

Sequence; same for both SEQRES and ATOM records:

>d3ne4a_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileglnfn
lteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaf
tvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdt
eeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhl
enelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvte
eaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmieqntkspl
fmgkvvnptq

Timeline for d3ne4a_:

• d3ne4a_ first appeared in SCOPe 2.04
  
• d3ne4a_ appears in SCOPe 2.05
  
• d3ne4a_ appears in SCOPe 2.07
  
• d3ne4a_ appears in the current release, SCOPe 2.08