SCOPe 2.04: Domain d3ndcb_: 3ndc B:

Lineage for d3ndcb_ (3ndc B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.0: automated matches [191315] (1 protein)
   not a true family

6. Protein automated matches [190076] (5 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:272942] [255976] (2 PDB entries)

8. Domain d3ndcb_: 3ndc B: [247886]
   automated match to d2cbfa_
   complexed with sah

Details for d3ndcb_

PDB Entry: 3ndc, 2 Å

PDB Description: Crystal structure of Precorrin-4 C11-methyltransferase from Rhodobacter capsulatus

PDB Compounds: (B:) Precorrin-4 C(11)-methyltransferase

SCOPe Domain Sequences for d3ndcb_:

Sequence, based on SEQRES records:

>d3ndcb_ c.90.1.0 (B:) automated matches {Rhodobacter capsulatus [TaxId: 272942]}
mtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapmsld
aiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaaatl
gaeltlpgvaqsviltrtsgrasampagetlenfartgavlaihlsvhvldevvqklvph
ygedcpvaivwraswpdqrvvratlatlqtslgaelertalilvgrslatedfdes

Sequence, based on observed residues (ATOM records):

>d3ndcb_ c.90.1.0 (B:) automated matches {Rhodobacter capsulatus [TaxId: 272942]}
mtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapmsld
aiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaaatl
gaeltlpgvaqsviltrtsgrasampagetlenfartgavlaihlsvhvldevvqklvph
ygedcpvaivwraswpdqrvvratlatlqtlertalilvgrslatedfdes

Timeline for d3ndcb_:

• d3ndcb_ is new in SCOPe 2.04-stable
  
• d3ndcb_ appears in SCOPe 2.05
  
• d3ndcb_ appears in the current release, SCOPe 2.08