Lineage for d3ndcb_ (3ndc B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911790Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2911791Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2912033Family c.90.1.0: automated matches [191315] (1 protein)
    not a true family
  6. 2912034Protein automated matches [190076] (5 species)
    not a true protein
  7. 2912047Species Rhodobacter capsulatus [TaxId:272942] [255976] (2 PDB entries)
  8. 2912049Domain d3ndcb_: 3ndc B: [247886]
    Other proteins in same PDB: d3ndca2
    automated match to d2cbfa_
    complexed with sah

Details for d3ndcb_

PDB Entry: 3ndc (more details), 2 Å

PDB Description: Crystal structure of Precorrin-4 C11-methyltransferase from Rhodobacter capsulatus
PDB Compounds: (B:) Precorrin-4 C(11)-methyltransferase

SCOPe Domain Sequences for d3ndcb_:

Sequence, based on SEQRES records: (download)

>d3ndcb_ c.90.1.0 (B:) automated matches {Rhodobacter capsulatus [TaxId: 272942]}
mtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapmsld
aiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaaatl
gaeltlpgvaqsviltrtsgrasampagetlenfartgavlaihlsvhvldevvqklvph
ygedcpvaivwraswpdqrvvratlatlqtslgaelertalilvgrslatedfdes

Sequence, based on observed residues (ATOM records): (download)

>d3ndcb_ c.90.1.0 (B:) automated matches {Rhodobacter capsulatus [TaxId: 272942]}
mtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapmsld
aiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaaatl
gaeltlpgvaqsviltrtsgrasampagetlenfartgavlaihlsvhvldevvqklvph
ygedcpvaivwraswpdqrvvratlatlqtlertalilvgrslatedfdes

SCOPe Domain Coordinates for d3ndcb_:

Click to download the PDB-style file with coordinates for d3ndcb_.
(The format of our PDB-style files is described here.)

Timeline for d3ndcb_: