Lineage for d3ndca_ (3ndc A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1877645Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 1877646Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 1877862Family c.90.1.0: automated matches [191315] (1 protein)
    not a true family
  6. 1877863Protein automated matches [190076] (5 species)
    not a true protein
  7. 1877876Species Rhodobacter capsulatus [TaxId:272942] [255976] (2 PDB entries)
  8. 1877877Domain d3ndca_: 3ndc A: [247885]
    automated match to d2cbfa_
    complexed with sah

Details for d3ndca_

PDB Entry: 3ndc (more details), 2 Å

PDB Description: Crystal structure of Precorrin-4 C11-methyltransferase from Rhodobacter capsulatus
PDB Compounds: (A:) Precorrin-4 C(11)-methyltransferase

SCOPe Domain Sequences for d3ndca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ndca_ c.90.1.0 (A:) automated matches {Rhodobacter capsulatus [TaxId: 272942]}
gshmtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapm
sldaiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaa
atlgaeltlpgvaqsviltrtsgrasampagetlenfartgavlaihlsvhvldevvqkl
vphygedcpvaivwraswpdqrvvratlatlqtslgaelertalilvgrslatedf

SCOPe Domain Coordinates for d3ndca_:

Click to download the PDB-style file with coordinates for d3ndca_.
(The format of our PDB-style files is described here.)

Timeline for d3ndca_: