| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
| Protein automated matches [190159] (12 species) not a true protein |
| Species Escherichia coli [TaxId:544404] [233005] (2 PDB entries) |
| Domain d3ncwd2: 3ncw D:841-934 [247884] Other proteins in same PDB: d3ncwa1, d3ncwb1, d3ncwc1, d3ncwd1 automated match to d2zqka2 |
PDB Entry: 3ncw (more details), 2.8 Å
SCOPe Domain Sequences for d3ncwd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ncwd2 d.169.1.0 (D:841-934) automated matches {Escherichia coli [TaxId: 544404]}
ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss
eqrsgvsstynlitqnplpgvnvntpnvyavcve
Timeline for d3ncwd2: