| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) ![]() |
| Family b.1.14.0: automated matches [231720] (1 protein) not a true family |
| Protein automated matches [231721] (3 species) not a true protein |
| Species Escherichia coli [TaxId:544404] [233003] (3 PDB entries) |
| Domain d3ncwd1: 3ncw D:752-840 [247883] Other proteins in same PDB: d3ncwa2, d3ncwb2, d3ncwc2, d3ncwd2 automated match to d2zqka1 |
PDB Entry: 3ncw (more details), 2.8 Å
SCOPe Domain Sequences for d3ncwd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ncwd1 b.1.14.0 (D:752-840) automated matches {Escherichia coli [TaxId: 544404]}
ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
vtlngkgsvvikatsgdkqtvsytikaps
Timeline for d3ncwd1: