Lineage for d1g3pa1 (1g3p A:1-65)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380416Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)
    core: barrel, in some members open; n*=4, S*=8; meander
  4. 2380417Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families) (S)
  5. 2380418Family b.37.1.1: N-terminal domains of the minor coat protein g3p [50177] (2 protein domains)
  6. 2380419Protein N-terminal domains of the minor coat protein g3p [50178] (2 species)
    duplication: the two domains share a common fold
  7. 2380426Species Bacteriophage M13 [TaxId:10870] [50179] (2 PDB entries)
  8. 2380427Domain d1g3pa1: 1g3p A:1-65 [24788]
    complexed with so4

Details for d1g3pa1

PDB Entry: 1g3p (more details), 1.46 Å

PDB Description: crystal structure of the n-terminal domains of bacteriophage minor coat protein g3p
PDB Compounds: (A:) minor coat protein

SCOPe Domain Sequences for d1g3pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3pa1 b.37.1.1 (A:1-65) N-terminal domains of the minor coat protein g3p {Bacteriophage M13 [TaxId: 10870]}
aetvesclakshtensftnvwkddktldryanyegclwnatgvvvctgdetqcygtwvpi
glaip

SCOPe Domain Coordinates for d1g3pa1:

Click to download the PDB-style file with coordinates for d1g3pa1.
(The format of our PDB-style files is described here.)

Timeline for d1g3pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g3pa2