Lineage for d3ncwa1 (3ncw A:752-840)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764897Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) (S)
  5. 2764917Family b.1.14.0: automated matches [231720] (1 protein)
    not a true family
  6. 2764918Protein automated matches [231721] (3 species)
    not a true protein
  7. 2764921Species Escherichia coli [TaxId:544404] [233003] (3 PDB entries)
  8. 2764924Domain d3ncwa1: 3ncw A:752-840 [247877]
    Other proteins in same PDB: d3ncwa2, d3ncwb2, d3ncwc2, d3ncwd2
    automated match to d2zqka1

Details for d3ncwa1

PDB Entry: 3ncw (more details), 2.8 Å

PDB Description: Crystal structure of EHEC O157:H7 intimin
PDB Compounds: (A:) Intimin adherence protein

SCOPe Domain Sequences for d3ncwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ncwa1 b.1.14.0 (A:752-840) automated matches {Escherichia coli [TaxId: 544404]}
ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
vtlngkgsvvikatsgdkqtvsytikaps

SCOPe Domain Coordinates for d3ncwa1:

Click to download the PDB-style file with coordinates for d3ncwa1.
(The format of our PDB-style files is described here.)

Timeline for d3ncwa1: