Class b: All beta proteins [48724] (180 folds) |
Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) Pfam PF11648 |
Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins) |
Protein RIG-I C-terminal domain [254412] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254851] (5 PDB entries) |
Domain d3ncub_: 3ncu B: [247876] automated match to d2rmja_ protein/RNA complex; complexed with zn |
PDB Entry: 3ncu (more details), 2.55 Å
SCOPe Domain Sequences for d3ncub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ncub_ b.88.2.1 (B:) RIG-I C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} enkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekrakif carqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpaem
Timeline for d3ncub_: