Lineage for d1i16a_ (1i16 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538854Family b.36.1.2: Interleukin 16 [50172] (1 protein)
  6. 1538855Protein Interleukin 16 [50173] (1 species)
  7. 1538856Species Human (Homo sapiens) [TaxId:9606] [50174] (2 PDB entries)
  8. 1538858Domain d1i16a_: 1i16 A: [24787]

Details for d1i16a_

PDB Entry: 1i16 (more details)

PDB Description: structure of interleukin 16: implications for function, nmr, 20 structures
PDB Compounds: (A:) interleukin 16

SCOPe Domain Sequences for d1i16a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]}
mpdlnsstdsaasasaasdvsvestaeatvctvtlekmsaglgfsleggkgslhgdkplt
inrifkgaaseqsetvqpgdeilqlggtamqgltrfeawniikalpdgpvtivirrkslq
skettaagds

SCOPe Domain Coordinates for d1i16a_:

Click to download the PDB-style file with coordinates for d1i16a_.
(The format of our PDB-style files is described here.)

Timeline for d1i16a_: