SCOP 1.73: Domain d1i16a_: 1i16 A:

Lineage for d1i16a_ (1i16 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.2: Interleukin 16 [50172] (1 protein)

6. Protein Interleukin 16 [50173] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50174] (2 PDB entries)

8. Domain d1i16a_: 1i16 A: [24787]

Details for d1i16a_

PDB Entry: 1i16

PDB Description: structure of interleukin 16: implications for function, nmr, 20 structures

PDB Compounds: (A:) interleukin 16

SCOP Domain Sequences for d1i16a_:

Sequence; same for both SEQRES and ATOM records:

>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]}
mpdlnsstdsaasasaasdvsvestaeatvctvtlekmsaglgfsleggkgslhgdkplt
inrifkgaaseqsetvqpgdeilqlggtamqgltrfeawniikalpdgpvtivirrkslq
skettaagds

Timeline for d1i16a_:

• d1i16a_ first appeared (with stable ids) in SCOP 1.55, called d1i16__
  
• d1i16a_ was called d1i16__ in SCOP 1.71
  
• d1i16a_ appears in SCOP 1.75
  
• d1i16a_ appears in the current release, SCOPe 2.08