Lineage for d1i16__ (1i16 -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13490Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 13491Superfamily b.36.1: PDZ domain-like [50156] (2 families) (S)
  5. 13523Family b.36.1.2: Interleukin 16 [50172] (1 protein)
  6. 13524Protein Interleukin 16 [50173] (1 species)
  7. 13525Species Human (Homo sapiens) [TaxId:9606] [50174] (1 PDB entry)
  8. 13526Domain d1i16__: 1i16 - [24787]

Details for d1i16__

PDB Entry: 1i16 (more details)

PDB Description: structure of interleukin 16: implications for function, nmr, 20 structures
PDB Compounds: ( :)

SCOP Domain Sequences for d1i16__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i16__ b.36.1.2 (-) Interleukin 16 {Human (Homo sapiens)}
mpdlnsstdsaasasaasdvsvestaeatvctvtlekmsaglgfsleggkgslhgdkplt
inrifkgaaseqsetvqpgdeilqlggtamqgltrfeawniikalpdgpvtivirrkslq
skettaagds

SCOP Domain Coordinates for d1i16__:

Click to download the PDB-style file with coordinates for d1i16__.
(The format of our PDB-style files is described here.)

Timeline for d1i16__: