Lineage for d1i16__ (1i16 -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily) Superfamily b.36.1: PDZ domain-like [50156] (2 families) 
Family b.36.1.2: Interleukin 16 [50172] (1 protein) Protein Interleukin 16 [50173] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50174] (1 PDB entry) 
Domain d1i16__: 1i16 - [24787]
Details for d1i16__
PDB Entry: 1i16 (more details)
PDB Description: structure of interleukin 16: implications for function, nmr, 20 structures
SCOP Domain Sequences for d1i16__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i16__ b.36.1.2 (-) Interleukin 16 {Human (Homo sapiens)}
mpdlnsstdsaasasaasdvsvestaeatvctvtlekmsaglgfsleggkgslhgdkplt
inrifkgaaseqsetvqpgdeilqlggtamqgltrfeawniikalpdgpvtivirrkslq
skettaagds
SCOP Domain Coordinates for d1i16__:
Click to download the PDB-style file with coordinates for d1i16__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i16__:
- d1i16__ appears in SCOP 1.57
- d1i16__ appears in the current release, SCOPe 2.08, called d1i16a_
View in 3D