Lineage for d3n7ma2 (3n7m A:1077-1284)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062236Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2062365Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2062366Protein automated matches [190445] (6 species)
    not a true protein
  7. 2062372Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries)
  8. 2062400Domain d3n7ma2: 3n7m A:1077-1284 [247868]
    Other proteins in same PDB: d3n7ma1
    automated match to d3r4sa2
    complexed with gol, so4; mutant

Details for d3n7ma2

PDB Entry: 3n7m (more details), 2.6 Å

PDB Description: Crystal structure of W1252A mutant of HCR D/C VPI 5995
PDB Compounds: (A:) Neurotoxin

SCOPe Domain Sequences for d3n7ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n7ma2 b.42.4.0 (A:1077-1284) automated matches {Clostridium botulinum [TaxId: 1491]}
ddkdinilfnslqytnvvkdywgndlrydkeyyminvnymnrymskkgngivfntrknnn
dfnegykiiikrirgntndtrvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgal
dqpmdeirkygsfiiqpcntfdyyasqlflssnattnrlgilsigsysfklgddyafnhe
ylipvikiehyaslleststhwvfvpas

SCOPe Domain Coordinates for d3n7ma2:

Click to download the PDB-style file with coordinates for d3n7ma2.
(The format of our PDB-style files is described here.)

Timeline for d3n7ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n7ma1