SCOPe 2.05: Domain d3n7ma1: 3n7m A:863-1076

Lineage for d3n7ma1 (3n7m A:863-1076)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225675] (21 PDB entries)

8. Domain d3n7ma1: 3n7m A:863-1076 [247867]
   Other proteins in same PDB: d3n7ma2
   automated match to d3r4sa1
   complexed with gol, so4; mutant

Details for d3n7ma1

PDB Entry: 3n7m, 2.6 Å

PDB Description: Crystal structure of W1252A mutant of HCR D/C VPI 5995

PDB Compounds: (A:) Neurotoxin

SCOPe Domain Sequences for d3n7ma1:

Sequence, based on SEQRES records:

>d3n7ma1 b.29.1.0 (A:863-1076) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskti
tfqmnkipntglitsdsdninmwirdfyifakel

Sequence, based on observed residues (ATOM records):

>d3n7ma1 b.29.1.0 (A:863-1076) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskti
tfqmnkipntglitninmwirdfyifakel

Timeline for d3n7ma1:

• d3n7ma1 first appeared in SCOPe 2.04
  
• d3n7ma1 appears in SCOPe 2.06
  
• d3n7ma1 appears in the current release, SCOPe 2.08