Lineage for d3n7ja1 (3n7j A:862-1067)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (53 species)
    not a true protein
  7. 2044196Species Clostridium botulinum [TaxId:1491] [225675] (23 PDB entries)
  8. 2044215Domain d3n7ja1: 3n7j A:862-1067 [247863]
    Other proteins in same PDB: d3n7ja2
    automated match to d3pmea1

Details for d3n7ja1

PDB Entry: 3n7j (more details), 2 Å

PDB Description: Crystal structure of botulinum neurotoxin serotype D binding domain
PDB Compounds: (A:) Botulinum neurotoxin type D

SCOPe Domain Sequences for d3n7ja1:

Sequence, based on SEQRES records: (download)

>d3n7ja1 b.29.1.0 (A:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
ilysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrk
ykslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldkti
vfgidenidenqmlwirdfnifskel

Sequence, based on observed residues (ATOM records): (download)

>d3n7ja1 b.29.1.0 (A:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
iliyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrkyks
lifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktivfg
idenidenqmlwirdfnifskel

SCOPe Domain Coordinates for d3n7ja1:

Click to download the PDB-style file with coordinates for d3n7ja1.
(The format of our PDB-style files is described here.)

Timeline for d3n7ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n7ja2