Lineage for d3n42f2 (3n42 F:293-393)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771099Species Chikungunya virus [TaxId:37124] [226027] (5 PDB entries)
  8. 1771103Domain d3n42f2: 3n42 F:293-393 [247856]
    Other proteins in same PDB: d3n42f1
    automated match to d3n40f2
    complexed with nag

Details for d3n42f2

PDB Entry: 3n42 (more details), 3 Å

PDB Description: crystal structures of the mature envelope glycoprotein complex (furin cleavage) of chikungunya virus.
PDB Compounds: (F:) e1 envelope glycoprotein

SCOPe Domain Sequences for d3n42f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n42f2 b.1.18.0 (F:293-393) automated matches {Chikungunya virus [TaxId: 37124]}
apsltdmscevpacthssdfggvaiikyaaskkgkcavhsmtnavtireaeievegnsql
qisfstalasaefrvqvcstqvhcaaechppkdhivnypas

SCOPe Domain Coordinates for d3n42f2:

Click to download the PDB-style file with coordinates for d3n42f2.
(The format of our PDB-style files is described here.)

Timeline for d3n42f2: