Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) |
Protein automated matches [226969] (5 species) not a true protein |
Species Chikungunya virus [TaxId:37124] [226028] (3 PDB entries) |
Domain d3n42f1: 3n42 F:1-292 [247855] Other proteins in same PDB: d3n42f2, d3n42f3 automated match to d3n40f1 complexed with nag |
PDB Entry: 3n42 (more details), 3 Å
SCOPe Domain Sequences for d3n42f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n42f1 f.10.1.1 (F:1-292) automated matches {Chikungunya virus [TaxId: 37124]} yehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipspyv kccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktefas ayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkivvy kgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqapsgf kywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvd
Timeline for d3n42f1: