Lineage for d3n42f1 (3n42 F:1-292)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022872Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 3022873Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 3022874Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins)
  6. 3022908Protein automated matches [226969] (5 species)
    not a true protein
  7. 3022909Species Chikungunya virus [TaxId:37124] [226028] (3 PDB entries)
  8. 3022911Domain d3n42f1: 3n42 F:1-292 [247855]
    Other proteins in same PDB: d3n42f2, d3n42f3
    automated match to d3n40f1
    complexed with nag

Details for d3n42f1

PDB Entry: 3n42 (more details), 3 Å

PDB Description: crystal structures of the mature envelope glycoprotein complex (furin cleavage) of chikungunya virus.
PDB Compounds: (F:) e1 envelope glycoprotein

SCOPe Domain Sequences for d3n42f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n42f1 f.10.1.1 (F:1-292) automated matches {Chikungunya virus [TaxId: 37124]}
yehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipspyv
kccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktefas
ayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkivvy
kgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqapsgf
kywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvd

SCOPe Domain Coordinates for d3n42f1:

Click to download the PDB-style file with coordinates for d3n42f1.
(The format of our PDB-style files is described here.)

Timeline for d3n42f1: