Lineage for d3n3ab_ (3n3a B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703643Species Escherichia coli K-12 [TaxId:83333] [255975] (6 PDB entries)
  8. 2703647Domain d3n3ab_: 3n3a B: [247848]
    automated match to d1uzrb_
    complexed with fmn, mn

Details for d3n3ab_

PDB Entry: 3n3a (more details), 1.99 Å

PDB Description: Ribonucleotide Reductase Dimanganese(II)-NrdF from Escherichia coli in Complex with Reduced NrdI
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase 2 subunit beta

SCOPe Domain Sequences for d3n3ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n3ab_ a.25.1.2 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
isainwnkisddkdlevwnrltsnfwlpekvplsndipawqtltvveqqltmrvftgltl
ldtlqnvigapslmpdaltpheeavlsnisfmeavharsyssifstlcqtkdvdaayaws
eenaplqrkaqiiqqhyrgddplkkkiasvflesflfysgfwlpmyfssrgkltntadli
rliirdeavhgyyigykyqknmekislgqreelksfafdlllelydnelqytdelyaetp
waddvkaflcynankalmnlgyeplfpaemaevnpailaals

SCOPe Domain Coordinates for d3n3ab_:

Click to download the PDB-style file with coordinates for d3n3ab_.
(The format of our PDB-style files is described here.)

Timeline for d3n3ab_: