SCOPe 2.07: Domain d3mwza1: 3mwz A:2-115

Lineage for d3mwza1 (3mwz A:2-115)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.0: automated matches [191407] (1 protein)
   not a true family

6. Protein automated matches [190558] (13 species)
   not a true protein

7. Species Ixodes scapularis [TaxId:6945] [255931] (3 PDB entries)

8. Domain d3mwza1: 3mwz A:2-115 [247838]
   Other proteins in same PDB: d3mwza2
   automated match to d4it7a_
   complexed with so4; mutant

Details for d3mwza1

PDB Entry: 3mwz, 1.52 Å

PDB Description: Crystal structure of the selenomethionine derivative of the L 22,47,100 M mutant of sialostatin L2

PDB Compounds: (A:) sialostatin L2

SCOPe Domain Sequences for d3mwza1:

Sequence; same for both SEQRES and ATOM records:

>d3mwza1 d.17.1.0 (A:2-115) automated matches {Ixodes scapularis [TaxId: 6945]}
elalrggyrersnqddpeylemahyatstwsaqqpgkthfdtvvevmkvetqtvagtnyr
ltlkvaestceltstynkdtcqananaaqrtcttviyrnmqgeksinsfecaaa

Timeline for d3mwza1:

• d3mwza1 first appeared in SCOPe 2.04, called d3mwza_
  
• d3mwza1 appears in SCOPe 2.06
  
• d3mwza1 appears in the current release, SCOPe 2.08