Lineage for d3mwza1 (3mwz A:2-115)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2542784Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2542960Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2542961Protein automated matches [190558] (13 species)
    not a true protein
  7. 2543003Species Ixodes scapularis [TaxId:6945] [255931] (3 PDB entries)
  8. 2543004Domain d3mwza1: 3mwz A:2-115 [247838]
    Other proteins in same PDB: d3mwza2
    automated match to d4it7a_
    complexed with so4; mutant

Details for d3mwza1

PDB Entry: 3mwz (more details), 1.52 Å

PDB Description: Crystal structure of the selenomethionine derivative of the L 22,47,100 M mutant of sialostatin L2
PDB Compounds: (A:) sialostatin L2

SCOPe Domain Sequences for d3mwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mwza1 d.17.1.0 (A:2-115) automated matches {Ixodes scapularis [TaxId: 6945]}
elalrggyrersnqddpeylemahyatstwsaqqpgkthfdtvvevmkvetqtvagtnyr
ltlkvaestceltstynkdtcqananaaqrtcttviyrnmqgeksinsfecaaa

SCOPe Domain Coordinates for d3mwza1:

Click to download the PDB-style file with coordinates for d3mwza1.
(The format of our PDB-style files is described here.)

Timeline for d3mwza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mwza2