SCOPe 2.04: Domain d3mwza_: 3mwz A:

Lineage for d3mwza_ (3mwz A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.0: automated matches [191407] (1 protein)
   not a true family

6. Protein automated matches [190558] (8 species)
   not a true protein

7. Species Ixodes scapularis [TaxId:6945] [255931] (2 PDB entries)

8. Domain d3mwza_: 3mwz A: [247838]
   automated match to d4it7a_
   complexed with so4; mutant

Details for d3mwza_

PDB Entry: 3mwz, 1.52 Å

PDB Description: Crystal structure of the selenomethionine derivative of the L 22,47,100 M mutant of sialostatin L2

PDB Compounds: (A:) sialostatin L2

SCOPe Domain Sequences for d3mwza_:

Sequence; same for both SEQRES and ATOM records:

>d3mwza_ d.17.1.0 (A:) automated matches {Ixodes scapularis [TaxId: 6945]}
melalrggyrersnqddpeylemahyatstwsaqqpgkthfdtvvevmkvetqtvagtny
rltlkvaestceltstynkdtcqananaaqrtcttviyrnmqgeksinsfecaaa

Timeline for d3mwza_:

• d3mwza_ is new in SCOPe 2.04-stable
  
• d3mwza_ appears in SCOPe 2.05
  
• d3mwza_ appears in the current release, SCOPe 2.08, called d3mwza1