Lineage for d3mv141 (3mv1 4:13-219)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777099Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1777100Protein beta-Galactosidase [49804] (2 species)
  7. 1777108Species Escherichia coli [TaxId:562] [49805] (42 PDB entries)
    Uniprot P00722
  8. 1777208Domain d3mv141: 3mv1 4:13-219 [247833]
    Other proteins in same PDB: d3mv112, d3mv113, d3mv114, d3mv115, d3mv122, d3mv123, d3mv124, d3mv125, d3mv132, d3mv133, d3mv134, d3mv135, d3mv142, d3mv143, d3mv144, d3mv145
    automated match to d1f49a3
    complexed with dms, gai, mg, na

Details for d3mv141

PDB Entry: 3mv1 (more details), 2.2 Å

PDB Description: e.coli (lacz) beta-galactosidase (r599a) in complex with guanidinium
PDB Compounds: (4:) beta-galactosidase

SCOPe Domain Sequences for d3mv141:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mv141 b.18.1.5 (4:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3mv141:

Click to download the PDB-style file with coordinates for d3mv141.
(The format of our PDB-style files is described here.)

Timeline for d3mv141: