Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Escherichia coli [TaxId:562] [49805] (42 PDB entries) Uniprot P00722 |
Domain d3mv141: 3mv1 4:13-219 [247833] Other proteins in same PDB: d3mv112, d3mv113, d3mv114, d3mv115, d3mv122, d3mv123, d3mv124, d3mv125, d3mv132, d3mv133, d3mv134, d3mv135, d3mv142, d3mv143, d3mv144, d3mv145 automated match to d1f49a3 complexed with dms, gai, mg, na |
PDB Entry: 3mv1 (more details), 2.2 Å
SCOPe Domain Sequences for d3mv141:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mv141 b.18.1.5 (4:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3mv141:
View in 3D Domains from same chain: (mouse over for more information) d3mv142, d3mv143, d3mv144, d3mv145 |