![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
![]() | Domain d3mv134: 3mv1 3:626-730 [247831] Other proteins in same PDB: d3mv111, d3mv113, d3mv115, d3mv121, d3mv123, d3mv125, d3mv131, d3mv133, d3mv135, d3mv141, d3mv143, d3mv145 automated match to d1jz8a2 complexed with dms, gai, mg, na |
PDB Entry: 3mv1 (more details), 2.2 Å
SCOPe Domain Sequences for d3mv134:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mv134 b.1.4.1 (3:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3mv134:
![]() Domains from same chain: (mouse over for more information) d3mv131, d3mv132, d3mv133, d3mv135 |