Lineage for d3mv123 (3mv1 2:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830653Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. 2830759Domain d3mv123: 3mv1 2:334-625 [247825]
    Other proteins in same PDB: d3mv111, d3mv112, d3mv114, d3mv115, d3mv121, d3mv122, d3mv124, d3mv125, d3mv131, d3mv132, d3mv134, d3mv135, d3mv141, d3mv142, d3mv144, d3mv145
    automated match to d1jz7a5
    complexed with dms, gai, mg, na

Details for d3mv123

PDB Entry: 3mv1 (more details), 2.2 Å

PDB Description: e.coli (lacz) beta-galactosidase (r599a) in complex with guanidinium
PDB Compounds: (2:) beta-galactosidase

SCOPe Domain Sequences for d3mv123:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mv123 c.1.8.3 (2:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndaqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3mv123:

Click to download the PDB-style file with coordinates for d3mv123.
(The format of our PDB-style files is described here.)

Timeline for d3mv123: