| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
| Protein beta-Galactosidase [49804] (3 species) |
| Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
| Domain d3mv111: 3mv1 1:13-219 [247818] Other proteins in same PDB: d3mv112, d3mv113, d3mv114, d3mv115, d3mv122, d3mv123, d3mv124, d3mv125, d3mv132, d3mv133, d3mv134, d3mv135, d3mv142, d3mv143, d3mv144, d3mv145 automated match to d1f49a3 complexed with dms, gai, mg, na |
PDB Entry: 3mv1 (more details), 2.2 Å
SCOPe Domain Sequences for d3mv111:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mv111 b.18.1.5 (1:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3mv111:
View in 3DDomains from same chain: (mouse over for more information) d3mv112, d3mv113, d3mv114, d3mv115 |