Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
Species Escherichia coli [TaxId:562] [49306] (42 PDB entries) Uniprot P00722 |
Domain d3mv042: 3mv0 4:220-333 [247814] Other proteins in same PDB: d3mv011, d3mv013, d3mv015, d3mv021, d3mv023, d3mv025, d3mv031, d3mv033, d3mv035, d3mv041, d3mv043, d3mv045 automated match to d1jz8a1 complexed with 149, dms, mg, na |
PDB Entry: 3mv0 (more details), 2.2 Å
SCOPe Domain Sequences for d3mv042:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mv042 b.1.4.1 (4:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3mv042:
View in 3D Domains from same chain: (mouse over for more information) d3mv041, d3mv043, d3mv044, d3mv045 |