SCOPe 2.06: Domain d1b8qa_: 1b8q A:

Lineage for d1b8qa_ (1b8q A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Neuronal nitric oxide synthase, NNOS [50166] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50167] (3 PDB entries)

8. Domain d1b8qa_: 1b8q A: [24781]

Details for d1b8qa_

PDB Entry: 1b8q

PDB Description: solution structure of the extended neuronal nitric oxide synthase pdz domain complexed with an associated peptide

PDB Compounds: (A:) protein (neuronal nitric oxide synthase)

SCOPe Domain Sequences for d1b8qa_:

Sequence; same for both SEQRES and ATOM records:

>d1b8qa_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gshmiepnvisvrlfkrkvgglgflvkervskppviisdlirggaaeqsgliqagdiila
vndrplvdlsydsalevlrgiasethvvlilrgpegftthlettftgdgtpktirvtqpl
gpptkav

Timeline for d1b8qa_:

• d1b8qa_ first appeared (with stable ids) in SCOP 1.55
  
• d1b8qa_ appears in SCOPe 2.05
  
• d1b8qa_ appears in SCOPe 2.07
  
• d1b8qa_ appears in the current release, SCOPe 2.08