Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
Species Escherichia coli [TaxId:562] [49306] (45 PDB entries) Uniprot P00722 |
Domain d3mv014: 3mv0 1:626-730 [247801] Other proteins in same PDB: d3mv011, d3mv013, d3mv015, d3mv021, d3mv023, d3mv025, d3mv031, d3mv033, d3mv035, d3mv041, d3mv043, d3mv045 automated match to d1jz8a2 complexed with 149, dms, mg, na |
PDB Entry: 3mv0 (more details), 2.2 Å
SCOPe Domain Sequences for d3mv014:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mv014 b.1.4.1 (1:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3mv014:
View in 3D Domains from same chain: (mouse over for more information) d3mv011, d3mv012, d3mv013, d3mv015 |