Lineage for d3mv014 (3mv0 1:626-730)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372435Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2372436Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2372450Species Escherichia coli [TaxId:562] [49306] (45 PDB entries)
    Uniprot P00722
  8. 2372612Domain d3mv014: 3mv0 1:626-730 [247801]
    Other proteins in same PDB: d3mv011, d3mv013, d3mv015, d3mv021, d3mv023, d3mv025, d3mv031, d3mv033, d3mv035, d3mv041, d3mv043, d3mv045
    automated match to d1jz8a2
    complexed with 149, dms, mg, na

Details for d3mv014

PDB Entry: 3mv0 (more details), 2.2 Å

PDB Description: e. coli (lacz) beta-galactosidase (r599a) in complex with d- galctopyranosyl-1-one
PDB Compounds: (1:) beta-galactosidase

SCOPe Domain Sequences for d3mv014:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mv014 b.1.4.1 (1:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3mv014:

Click to download the PDB-style file with coordinates for d3mv014.
(The format of our PDB-style files is described here.)

Timeline for d3mv014: