SCOPe 2.06: Domain d1qavb_: 1qav B:

Lineage for d1qavb_ (1qav B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Neuronal nitric oxide synthase, NNOS [50166] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50167] (3 PDB entries)

8. Domain d1qavb_: 1qav B: [24780]
   Other proteins in same PDB: d1qava_

Details for d1qavb_

PDB Entry: 1qav, 1.9 Å

PDB Description: Unexpected Modes of PDZ Domain Scaffolding Revealed by Structure of NNOS-Syntrophin Complex

PDB Compounds: (B:) neuronal nitric oxide synthase (residues 1-130)

SCOPe Domain Sequences for d1qavb_:

Sequence; same for both SEQRES and ATOM records:

>d1qavb_ b.36.1.1 (B:) Neuronal nitric oxide synthase, NNOS {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qpnvisvrlfkrkvgglgflvkervskppviisdlirggaaeqsgliqagdiilavndrp
lvdlsydsalevlrgiasethvvlilrgpegftthlettftgdgtpktirvtqpl

Timeline for d1qavb_:

• d1qavb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qavb_ appears in SCOPe 2.05
  
• d1qavb_ appears in SCOPe 2.07
  
• d1qavb_ appears in the current release, SCOPe 2.08