Lineage for d3muz45 (3muz 4:731-1023)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391262Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2391263Protein beta-Galactosidase, domain 5 [49996] (3 species)
  7. 2391271Species Escherichia coli [TaxId:562] [49997] (45 PDB entries)
    Uniprot P00722
  8. 2391327Domain d3muz45: 3muz 4:731-1023 [247797]
    Other proteins in same PDB: d3muz11, d3muz12, d3muz13, d3muz14, d3muz21, d3muz22, d3muz23, d3muz24, d3muz31, d3muz32, d3muz33, d3muz34, d3muz41, d3muz42, d3muz43, d3muz44
    automated match to d1jz8a4
    complexed with dms, ipt, mg, na

Details for d3muz45

PDB Entry: 3muz (more details), 1.9 Å

PDB Description: e.coli (lacz) beta-galactosidase (r599a) in complex with iptg
PDB Compounds: (4:) beta-galactosidase

SCOPe Domain Sequences for d3muz45:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muz45 b.30.5.1 (4:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3muz45:

Click to download the PDB-style file with coordinates for d3muz45.
(The format of our PDB-style files is described here.)

Timeline for d3muz45: