Lineage for d3muz44 (3muz 4:626-730)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2030012Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2030013Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 protein domains)
  6. 2030014Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 2030028Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
    Uniprot P00722
  8. 2030156Domain d3muz44: 3muz 4:626-730 [247796]
    Other proteins in same PDB: d3muz11, d3muz13, d3muz15, d3muz21, d3muz23, d3muz25, d3muz31, d3muz33, d3muz35, d3muz41, d3muz43, d3muz45
    automated match to d1jz8a2
    complexed with dms, ipt, mg, na

Details for d3muz44

PDB Entry: 3muz (more details), 1.9 Å

PDB Description: E.Coli (lacZ) beta-galactosidase (R599A) in complex with IPTG
PDB Compounds: (4:) beta-galactosidase

SCOPe Domain Sequences for d3muz44:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muz44 b.1.4.1 (4:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3muz44:

Click to download the PDB-style file with coordinates for d3muz44.
(The format of our PDB-style files is described here.)

Timeline for d3muz44: