![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
![]() | Protein beta-Galactosidase, domain 5 [49996] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [49997] (41 PDB entries) Uniprot P00722 |
![]() | Domain d3muz35: 3muz 3:731-1023 [247792] Other proteins in same PDB: d3muz11, d3muz12, d3muz13, d3muz14, d3muz21, d3muz22, d3muz23, d3muz24, d3muz31, d3muz32, d3muz33, d3muz34, d3muz41, d3muz42, d3muz43, d3muz44 automated match to d1jz8a4 complexed with dms, ipt, mg, na |
PDB Entry: 3muz (more details), 1.9 Å
SCOPe Domain Sequences for d3muz35:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muz35 b.30.5.1 (3:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3muz35:
![]() Domains from same chain: (mouse over for more information) d3muz31, d3muz32, d3muz33, d3muz34 |