Lineage for d3muz34 (3muz 3:626-730)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762432Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2762446Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
    Uniprot P00722
  8. 2762548Domain d3muz34: 3muz 3:626-730 [247791]
    Other proteins in same PDB: d3muz11, d3muz13, d3muz15, d3muz21, d3muz23, d3muz25, d3muz31, d3muz33, d3muz35, d3muz41, d3muz43, d3muz45
    automated match to d1jz8a2
    complexed with dms, ipt, mg, na

Details for d3muz34

PDB Entry: 3muz (more details), 1.9 Å

PDB Description: e.coli (lacz) beta-galactosidase (r599a) in complex with iptg
PDB Compounds: (3:) beta-galactosidase

SCOPe Domain Sequences for d3muz34:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muz34 b.1.4.1 (3:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3muz34:

Click to download the PDB-style file with coordinates for d3muz34.
(The format of our PDB-style files is described here.)

Timeline for d3muz34: