Lineage for d1qaua_ (1qau A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786012Protein Neuronal nitric oxide synthase, NNOS [50166] (1 species)
  7. 2786013Species Norway rat (Rattus norvegicus) [TaxId:10116] [50167] (3 PDB entries)
  8. 2786014Domain d1qaua_: 1qau A: [24779]

Details for d1qaua_

PDB Entry: 1qau (more details), 1.25 Å

PDB Description: unexpected modes of pdz domain scaffolding revealed by structure of nnos-syntrophin complex
PDB Compounds: (A:) neuronal nitric oxide synthase (residues 1-130)

SCOPe Domain Sequences for d1qaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nvisvrlfkrkvgglgflvkervskppviisdlirggaaeqsgliqagdiilavndrplv
dlsydsalevlrgiasethvvlilrgpegftthlettftgdgtpktirvtqp

SCOPe Domain Coordinates for d1qaua_:

Click to download the PDB-style file with coordinates for d1qaua_.
(The format of our PDB-style files is described here.)

Timeline for d1qaua_: