| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
| Protein beta-Galactosidase [49804] (3 species) |
| Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
| Domain d3muz31: 3muz 3:13-219 [247788] Other proteins in same PDB: d3muz12, d3muz13, d3muz14, d3muz15, d3muz22, d3muz23, d3muz24, d3muz25, d3muz32, d3muz33, d3muz34, d3muz35, d3muz42, d3muz43, d3muz44, d3muz45 automated match to d1f49a3 complexed with dms, ipt, mg, na |
PDB Entry: 3muz (more details), 1.9 Å
SCOPe Domain Sequences for d3muz31:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muz31 b.18.1.5 (3:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3muz31:
View in 3DDomains from same chain: (mouse over for more information) d3muz32, d3muz33, d3muz34, d3muz35 |