Lineage for d3muz23 (3muz 2:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439329Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2439337Species Escherichia coli [TaxId:562] [51511] (45 PDB entries)
    Uniprot P00722
  8. 2439391Domain d3muz23: 3muz 2:334-625 [247785]
    Other proteins in same PDB: d3muz11, d3muz12, d3muz14, d3muz15, d3muz21, d3muz22, d3muz24, d3muz25, d3muz31, d3muz32, d3muz34, d3muz35, d3muz41, d3muz42, d3muz44, d3muz45
    automated match to d1jz7a5
    complexed with dms, ipt, mg, na

Details for d3muz23

PDB Entry: 3muz (more details), 1.9 Å

PDB Description: e.coli (lacz) beta-galactosidase (r599a) in complex with iptg
PDB Compounds: (2:) beta-galactosidase

SCOPe Domain Sequences for d3muz23:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muz23 c.1.8.3 (2:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndaqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3muz23:

Click to download the PDB-style file with coordinates for d3muz23.
(The format of our PDB-style files is described here.)

Timeline for d3muz23: