Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (3 species) |
Species Escherichia coli [TaxId:562] [51511] (45 PDB entries) Uniprot P00722 |
Domain d3muz23: 3muz 2:334-625 [247785] Other proteins in same PDB: d3muz11, d3muz12, d3muz14, d3muz15, d3muz21, d3muz22, d3muz24, d3muz25, d3muz31, d3muz32, d3muz34, d3muz35, d3muz41, d3muz42, d3muz44, d3muz45 automated match to d1jz7a5 complexed with dms, ipt, mg, na |
PDB Entry: 3muz (more details), 1.9 Å
SCOPe Domain Sequences for d3muz23:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muz23 c.1.8.3 (2:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndaqfcmnglvfadrtphpalteakhqqq
Timeline for d3muz23:
View in 3D Domains from same chain: (mouse over for more information) d3muz21, d3muz22, d3muz24, d3muz25 |