Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
Species Escherichia coli [TaxId:562] [49306] (42 PDB entries) Uniprot P00722 |
Domain d3muz22: 3muz 2:220-333 [247784] Other proteins in same PDB: d3muz11, d3muz13, d3muz15, d3muz21, d3muz23, d3muz25, d3muz31, d3muz33, d3muz35, d3muz41, d3muz43, d3muz45 automated match to d1jz8a1 complexed with dms, ipt, mg, na |
PDB Entry: 3muz (more details), 1.9 Å
SCOPe Domain Sequences for d3muz22:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muz22 b.1.4.1 (2:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3muz22:
View in 3D Domains from same chain: (mouse over for more information) d3muz21, d3muz23, d3muz24, d3muz25 |