![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein beta-Galactosidase [49804] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
![]() | Domain d3muz11: 3muz 1:13-219 [247778] Other proteins in same PDB: d3muz12, d3muz13, d3muz14, d3muz15, d3muz22, d3muz23, d3muz24, d3muz25, d3muz32, d3muz33, d3muz34, d3muz35, d3muz42, d3muz43, d3muz44, d3muz45 automated match to d1f49a3 complexed with dms, ipt, mg, na |
PDB Entry: 3muz (more details), 1.9 Å
SCOPe Domain Sequences for d3muz11:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muz11 b.18.1.5 (1:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3muz11:
![]() Domains from same chain: (mouse over for more information) d3muz12, d3muz13, d3muz14, d3muz15 |