Lineage for d3muz11 (3muz 1:13-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774242Species Escherichia coli [TaxId:562] [49805] (46 PDB entries)
    Uniprot P00722
  8. 2774291Domain d3muz11: 3muz 1:13-219 [247778]
    Other proteins in same PDB: d3muz12, d3muz13, d3muz14, d3muz15, d3muz22, d3muz23, d3muz24, d3muz25, d3muz32, d3muz33, d3muz34, d3muz35, d3muz42, d3muz43, d3muz44, d3muz45
    automated match to d1f49a3
    complexed with dms, ipt, mg, na

Details for d3muz11

PDB Entry: 3muz (more details), 1.9 Å

PDB Description: e.coli (lacz) beta-galactosidase (r599a) in complex with iptg
PDB Compounds: (1:) beta-galactosidase

SCOPe Domain Sequences for d3muz11:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muz11 b.18.1.5 (1:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3muz11:

Click to download the PDB-style file with coordinates for d3muz11.
(The format of our PDB-style files is described here.)

Timeline for d3muz11: