| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (19 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
| Domain d3muy42: 3muy 4:220-333 [247774] Other proteins in same PDB: d3muy11, d3muy13, d3muy15, d3muy21, d3muy23, d3muy25, d3muy31, d3muy33, d3muy35, d3muy41, d3muy43, d3muy45 automated match to d1jz8a1 complexed with dms, mg, na |
PDB Entry: 3muy (more details), 2.5 Å
SCOPe Domain Sequences for d3muy42:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muy42 b.1.4.0 (4:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3muy42:
View in 3DDomains from same chain: (mouse over for more information) d3muy41, d3muy43, d3muy44, d3muy45 |