Lineage for d3muy41 (3muy 4:13-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775086Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2775118Domain d3muy41: 3muy 4:13-219 [247773]
    Other proteins in same PDB: d3muy12, d3muy13, d3muy14, d3muy15, d3muy22, d3muy23, d3muy24, d3muy25, d3muy32, d3muy33, d3muy34, d3muy35, d3muy42, d3muy43, d3muy44, d3muy45
    automated match to d1f49a3
    complexed with dms, mg, na

Details for d3muy41

PDB Entry: 3muy (more details), 2.5 Å

PDB Description: e. coli (lacz) beta-galactosidase (r599a)
PDB Compounds: (4:) Beta-D-galactosidase

SCOPe Domain Sequences for d3muy41:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muy41 b.18.1.0 (4:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3muy41:

Click to download the PDB-style file with coordinates for d3muy41.
(The format of our PDB-style files is described here.)

Timeline for d3muy41: