| Class b: All beta proteins [48724] (180 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
| Protein automated matches [226849] (8 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
| Domain d3muy35: 3muy 3:731-1023 [247772] Other proteins in same PDB: d3muy11, d3muy12, d3muy13, d3muy14, d3muy21, d3muy22, d3muy23, d3muy24, d3muy31, d3muy32, d3muy33, d3muy34, d3muy41, d3muy42, d3muy43, d3muy44 automated match to d1jz8a4 complexed with dms, mg, na |
PDB Entry: 3muy (more details), 2.5 Å
SCOPe Domain Sequences for d3muy35:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muy35 b.30.5.0 (3:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3muy35:
View in 3DDomains from same chain: (mouse over for more information) d3muy31, d3muy32, d3muy33, d3muy34 |