Lineage for d3muy32 (3muy 3:220-333)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763012Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries)
  8. 2763073Domain d3muy32: 3muy 3:220-333 [247769]
    Other proteins in same PDB: d3muy11, d3muy13, d3muy15, d3muy21, d3muy23, d3muy25, d3muy31, d3muy33, d3muy35, d3muy41, d3muy43, d3muy45
    automated match to d1jz8a1
    complexed with dms, mg, na

Details for d3muy32

PDB Entry: 3muy (more details), 2.5 Å

PDB Description: e. coli (lacz) beta-galactosidase (r599a)
PDB Compounds: (3:) Beta-D-galactosidase

SCOPe Domain Sequences for d3muy32:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muy32 b.1.4.0 (3:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d3muy32:

Click to download the PDB-style file with coordinates for d3muy32.
(The format of our PDB-style files is described here.)

Timeline for d3muy32: