| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
| Protein automated matches [190075] (132 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
| Domain d3muy23: 3muy 2:334-625 [247765] Other proteins in same PDB: d3muy11, d3muy12, d3muy14, d3muy15, d3muy21, d3muy22, d3muy24, d3muy25, d3muy31, d3muy32, d3muy34, d3muy35, d3muy41, d3muy42, d3muy44, d3muy45 automated match to d1jz7a5 complexed with dms, mg, na |
PDB Entry: 3muy (more details), 2.5 Å
SCOPe Domain Sequences for d3muy23:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muy23 c.1.8.0 (2:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndaqfcmnglvfadrtphpalteakhqqq
Timeline for d3muy23:
View in 3DDomains from same chain: (mouse over for more information) d3muy21, d3muy22, d3muy24, d3muy25 |