Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (31 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
Domain d3muy21: 3muy 2:13-219 [247763] Other proteins in same PDB: d3muy12, d3muy13, d3muy14, d3muy15, d3muy22, d3muy23, d3muy24, d3muy25, d3muy32, d3muy33, d3muy34, d3muy35, d3muy42, d3muy43, d3muy44, d3muy45 automated match to d1f49a3 complexed with dms, mg, na |
PDB Entry: 3muy (more details), 2.5 Å
SCOPe Domain Sequences for d3muy21:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muy21 b.18.1.0 (2:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3muy21:
View in 3D Domains from same chain: (mouse over for more information) d3muy22, d3muy23, d3muy24, d3muy25 |