Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (7 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
Domain d3muy14: 3muy 1:626-730 [247761] Other proteins in same PDB: d3muy11, d3muy13, d3muy15, d3muy21, d3muy23, d3muy25, d3muy31, d3muy33, d3muy35, d3muy41, d3muy43, d3muy45 automated match to d1jz8a2 complexed with dms, mg, na |
PDB Entry: 3muy (more details), 2.5 Å
SCOPe Domain Sequences for d3muy14:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muy14 b.1.4.0 (1:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3muy14:
View in 3D Domains from same chain: (mouse over for more information) d3muy11, d3muy12, d3muy13, d3muy15 |